35 caterers in Birmingham, AL
We tracked down 69 possible caterers around Birmingham and Trussville, Irondale, Alabaster, Helena, Mountain Brook and 4 more nearby towns, then checked each one against its own website. These are the 35 we could verify. Not a top ten, and not a paid directory.
5 of them (14%) publish their pricing. Those are listed first with the real numbers. The other 30 quote on request, which is normal in this industry, so plan on contacting several to compare.
Know a Birmingham catererwe're missing, or spot something wrong on a listing? Tell us and we'll fix it.
The Birmingham caterers list
Table and Thyme Catering
BirminghamTable & Thyme is a full-service Birmingham, Alabama catering company that offers elevated wedding menus, including customizable options, seasonal fare, and grazing tables. It is a strong fit for couples seeking polished food and service for intimate or larger celebrations.
from $85/guestCuisine: southern, american, seasonal +3Service: buffet, plated, food stations +4Bar service: NoPer-guest catering pricing starting at $85 per person for wedding meals.
elevatedelegantSouthernseasonalfull-servicecustomizableValor Catering and Bakery
TrussvilleValor Catering and Bakery is a delivery-based Alabama bakery and caterer offering wedding cakes, buffet catering, and custom sweets for weddings and special events.
from $25/guestCuisine: southern, american, comfort food +3Service: buffet, food stations, small plates +1Bar service: NoWedding catering with per-guest meal pricing and wedding cake per-serving pricing; also includes non-wedding hors d'oeuvres and bar items.
southerncomfort foodcustom cakebuffetlocalfamily-styleCatered To You Events LLC
IrondaleCatered To You Events is a Birmingham-area Southern caterer offering BBQ and elevated Southern menus for weddings, corporate events, and family gatherings. The business highlights chef-led menus, per-guest pricing, and a focus on fresh, flavorful food.
$32/guest – $62/guestCuisine: southern, bbq, italian +3Service: buffet, plated, food stationsBar service: NoPer-guest catering pricing for wedding meal packages ranging from $32 to $62, with premium protein upgrades available.
southernbbqelegantgourmetfreshcomfort foodOlexa's Catering, Cafe and Cakes
BirminghamOlexa's is a Mountain Brook café, cake shop, and full-service caterer offering wedding cakes, rehearsal dinners, bridal luncheons, and wedding receptions. They can cater at your venue or at their café with custom menus and event styling.
from $1/guestService: full-service catering, custom menus, reception catering +4Bar service: NoWedding cake requires $400 deposit; rehearsal dinner item has $1 per-guest upcharge; detailed wedding cake pricing in 2025 PDF not provided.
full-servicecustom menuscafécake-focusedelegantclassic1918 Catering
Birmingham1918 Catering is a full-service Birmingham-area caterer focused on Southern comfort food, smoked meats, and build-your-menu per-person pricing. It is a practical option for couples who want a flexible, food-forward catering menu for a wedding or other special event.
$16/guest – $42/guestCuisine: southern, bbq, comfort food +1Service: buffet, family-style, food stations +3Bar service: NoPer-person catering pricing for wedding menus ranging from $15.75 to $42.00 per guest.
southerncomfort foodcasualbbqfamily-stylefood stationsEight Eleven Catering
BirminghamEight Eleven Catering is a chef-owned and operated catering company in the Birmingham, AL area that offers customized wedding reception menus and full-service catering for weddings, private events, and corporate gatherings.
Pricing on requestCuisine: southern, soul food, customizedService: plated, customized menus, cocktail parties +2Bar service: NoWedding catering pricing available by request only; no published rates provided.
elegantsoulfulcustomizedfine diningchef-drivensophisticatedIz weddings and Events
BirminghamIz Weddings and Events is a Birmingham-area full-service catering company focused on weddings and special events, with a personal, customized planning approach.
Pricing on requestCuisine: custom menus, southern, italian-influencedService: full-service catering, customized menus, cocktail dinner +1Bar service: Nopersonalizedfull-serviceelegantcustom menusSouthernItalian-influencedKathy G & Company Catering
BirminghamKathy G & Company is a Birmingham, Alabama caterer that presents weddings as its core specialty and offers catering for receptions, rehearsal dinners, bridal showers, and luncheons.
Pricing on requestCuisine: southern, gourmet, farm to table +1Service: plated, buffet, cocktail party +2Bar service: NoCatering pricing is customized by budget and event size; no specific prices published.
elegantsoutherngardenformalupscalecreativeL'Chris Catering & Company, LLC
BirminghamL'Chris Catering & Company is a Hoover, Alabama caterer offering wedding menus, buffet and seated dinners, and event coordination. They emphasize custom menus, fresh ingredients, and presentation that matches the couple's theme and budget.
Pricing on requestCuisine: american, southern, bbq +3Service: buffet, plated, appetizer stations +1Bar service: NoAll pricing for this caterer requires direct inquiry; no published rates available.
customelegantbuffetplatedappetizer stationsSouthernThe Happy Catering Co
BirminghamThe Happy Catering Company is a full-service Birmingham-area caterer with a dedicated wedding page, custom menu planning, tastings, and experience with receptions, rehearsal dinners, showers, and engagement parties.
Pricing on requestCuisine: southern, bbq, american +5Service: buffet, plated, food stations +4Bar service: NoWedding pricing requires custom proposal; only individual line-item prices listed are below wedding catering floor.
elegantformalsoutherncustomizablefull-servicecasual-to-formalBayles Catering and Restaurant
BirminghamBayles Catering and Restaurant is a Birmingham-area full-service caterer offering custom menus and buffet-style service for weddings, engagement parties, showers, and rehearsal dinners.
Pricing on requestCuisine: southern, american, casseroles +3Service: buffet, food stations, box lunches / trays +2Bar service: NoBudget-friendly catering mentioned but no specific pricing amounts published.
full-servicebuffetcustom menubudget-friendlySoutherncasualThe Bright Star Catering Company
BirminghamThe Bright Star Catering Company is a Bessemer-based caterer offering wedding and corporate event catering with formal table service, buffet, and hors d'oeuvres menus.
Pricing on requestCuisine: southernService: plated, buffet, hors d'oeuvresBar service: NoformaltraditionalSouthernclassicTre Luna Catering
BirminghamTre Luna Catering is a family-owned Birmingham caterer offering customizable menus and full-service catering for weddings and other events.
Pricing on requestService: buffet, plated, pickup +3Bar service: NoPer-person pricing structure stated but no dollar amounts published; wedding pricing by inquiry.
family-ownedcustomizableprofessionalelevatedfull-servicepersonalizedCorretti
BirminghamCorretti Catering is an upscale Birmingham, AL caterer offering customizable menus for weddings, parties, and corporate events. The business emphasizes high-quality ingredients, polished presentation, and full-service catering for events of varying sizes.
Pricing on requestCuisine: southern, italian, american +5Service: buffet, plated, box lunch +5Bar service: NoOnly individual item pricing provided (baked goods per dozen, salad substitutions); no wedding packages or per-guest meal pricing.
upscaleelegantSouthernfine diningcustomizablefull-serviceJoe's Italian
AlabasterFamily-owned Italian-American restaurant in Alabaster offering full-service wedding catering, custom bakery cake, and bar support across the Birmingham metro and Shelby County.
Pricing on requestCuisine: italian-american, fresh pasta, pizza +4Service: drop-off, buffet with service staff, full-service plated +1Bar service: YesWedding catering pricing is quoted per event with no published dollar amounts; customers must inquire for rates.
italian-americanfamily-stylefull-servicerusticlocalwarmCatering by Bellinis
BirminghamCatering by Bellinis is a full-service Birmingham caterer that offers wedding and reception catering with custom menus, existing menu selections, and dietary accommodations. The company also provides event planning, staffing, tastings, and private dining options at Bellinis.
Pricing on requestService: boxed, buffet, table serviceBar service: Nofull-servicecustom menureception cateringcorporate cateringprivate diningMajestic Catering Services
BirminghamMajestic Catering Services is a locally owned Birmingham-area caterer offering wedding, rehearsal dinner, and anniversary catering with an emphasis on personal service and affordable pricing.
Pricing on requestService: buffet, full-service, deliveryBar service: NoNo specific pricing amounts provided; vendor describes pricing as affordable but requires inquiry for actual quotes.
traditionalfull-serviceaffordablepersonalizedclassicSavoie
BirminghamSavoie Catering is a Birmingham, AL catering company that offers fresh, seasonal, and locally sourced menus for events including weddings. It provides reception and neighborhood menus with buffet and served options.
Pricing on requestCuisine: southern, creole, gulf coast +4Service: buffet, served, food stations +2Bar service: YessouthernmodernrusticseasonallocalelegantWilton's Catering
HelenaWilton's Catering is a family-owned, full-service caterer in Loachapoka, AL that serves weddings, rehearsal dinners, and other special events. They offer scratch-made Southern-style menus and help customize service to fit the event and budget.
Pricing on requestCuisine: southern, comfort food, seafood +4Service: full-service catering, food stations, private dining +1Bar service: NoWedding catering pricing available by customized menu; no specific dollar amounts published.
southerncomfort foodfull-servicecustom menulocalEvent Espresso
TrussvilleEvent Espresso is a mobile coffee and espresso bar that brings a café-style beverage service to weddings, brunches, receptions, and other events.
Pricing on requestService: beverage station, mobile bar, on-site barista serviceBar service: NoWedding catering pricing requires custom inquiry with date, location, and guest count.
modernpremiumcafe-stylecustomizableminimal setupmobile barMeals by Misty
TrussvilleMeals by Misty is an Alabama-based gourmet market and caterer offering full-service catering for weddings and other events. Their menu centers on homemade, Southern-style comfort food, sides, salads, and desserts.
Pricing on requestCuisine: southern, american comfort food, homestyleService: buffet, family-style, food stations +1Bar service: NoPer-serving catering line-item pricing for individual menu components and bars; all amounts fall below realistic wedding catering per-guest levels.
southerncomfort foodhomestylefamily-stylecasualgourmet marketSherry's Cafe Cakes & Catering
TrussvilleSherry's Cafe is a Trussville, AL catering business with 35 years of experience that offers complete catering for weddings, rehearsal dinners, and office parties. The site highlights decorated cakes and fresh flowers as part of its catering services.
Pricing on requestBar service: Noclassicfull-servicecake-inclusivefloral accentsDish'n It Out
Mountain BrookDish'n It Out is a Birmingham caterer offering home-style gourmet meals and special event catering for weddings, engagement parties, and other gatherings. Menus can be designed to suit the occasion and budget, with chilled or frozen containers for easy heat-and-serve.
Pricing on requestCuisine: southern, home-style, comfort food +1Service: buffet, family-style, takeout +2Bar service: NoGroup sandwich menu at $9 per person is below wedding catering floor and represents non-wedding boxed-lunch pricing.
home-stylecomfort foodSoutherncasualpracticalbudget-friendlyMillie Lorraine, LLC
PelhamMillie Lorraine is a Pelham, Alabama caterer offering full-service, customized catering for weddings and other events. Their menu features Southern-inspired dishes made from scratch.
Pricing on requestCuisine: southernService: full-serviceBar service: NoOnly a deposit amount is listed; no actual wedding catering pricing is published.
southernhome-stylecustomizedfull-servicePanther Bites Catering
AlabasterFamily-owned Alabama caterer offering buffet, plated, and station-style menus for weddings, corporate events, and game-day gatherings. The business also provides custom tiered wedding cakes with delivery and onsite assembly.
Pricing on requestCuisine: southern, bbq, cajun +4Service: buffet, plated, food stations +4Bar service: NoPer-person catering prices ($8.50–$9.00) fall below typical wedding meal thresholds and indicate standard event/corporate catering, not wedding-specific pricing.
southerncasualfamily-stylebuffetplatedfood stationsSorelle Cafe
HomewoodSorelle Cafe is a neighborhood café in Homewood, AL that offers comfort-food menus and event catering, including options for weddings and other celebrations.
Pricing on requestCuisine: café comfort food, grab-and-go meals, rotating weekly dishes +4neighborhoodcomfort foodcasualhome-cookedevent cateringVaughan and Company
BirminghamVaughan and Company is a Birmingham, AL caterer offering customized event menus, chef-crafted meals, and family-style or plated-style options for gatherings of all sizes.
Pricing on requestCuisine: southern, american, comfort food +4Service: family-style, plated, buffet +3Bar service: NoSoutherncomfort foodcustomizedfamily-stylegourmetevent cateringFrios Gourmet Pops - Cullman Ice Cream Shop, Truck & Catering
CullmanFrios Gourmet Pops is a Cullman-based gourmet frozen pop shop and ice cream truck that offers event catering, including weddings, with customizable Sweet Ride, pop cart, or drop-off pop options.
Pricing on requestService: food trucks, food stations, drop-off +1Bar service: Nofunmoderncolorfulcasualdessert-focusedinteractiveFront Porch
HooverFront Porch at Ross Bridge is a family-friendly Hoover restaurant offering upscale Southern cuisine, fresh baked pizzas, and a full-service bar. It also lists a catering menu, making it a potential casual catering option for weddings.
Pricing on requestCuisine: southern, american, pizza +2Service: per-person entrees, food stations, family-styleBar service: YesPer-person catering pricing at $13–$15 is below typical wedding meal thresholds and suggests boxed lunch or casual event catering.
casualfamily-friendlysouthernneighborhoodupscale casualHomewood Gourmet
HomewoodHomewood Gourmet is a locally owned Homewood restaurant offering fast-casual sandwiches, salads, and made-from-scratch Southern and New Orleans-inspired food, with catering for parties, luncheons, and dinners.
Pricing on requestCuisine: southern, new orleans-inspired, american +3Service: platters, box lunches, appetizers +2Bar service: NoAll published prices are for non-wedding catering items (box lunches, platters, salads, casseroles) below wedding meal thresholds.
casualsouthernnew orleans-inspiredlocalseasonalfast-casualJohnny's Bar-B-Q
CullmanJohnny's Bar-B-Q is a Cullman, Alabama barbecue restaurant that offers catering for events, including wedding rehearsals, and can support larger gatherings with a vending trailer.
Pricing on requestCuisine: southern, bbqService: buffet, family-style, food stationsBar service: NoOnly restaurant and carry-out menu pricing provided; catering pricing requires inquiry.
casualsouthernbarbecuefamily-stylecomfort foodOusler's Sandwiches
BirminghamOusler's Sandwiches is a long-standing Birmingham-area sandwich shop that offers made-to-order finger sandwiches and fresh spreads for events, including weddings.
Pricing on requestService: small plates, finger sandwiches, self-serve / passed bitesBar service: NoRetail sandwich and box lunch pricing; no wedding-specific packages or per-guest meal pricing.
traditionalcasualSouthernsmall platesparty cateringPeach Cobbler Factory Trussville
TrussvillePeach Cobbler Factory is a dessert-focused chain offering warm cobblers, banana pudding, ice cream, shakes, cookies, and other sweet treats. It also offers catering for weddings and other events.
Pricing on requestCuisine: warm cobblers, banana pudding, ice cream +9casualdessert-focusedsweetfamily-friendlyevent-friendlypeachcobblerfactory.com(205) 508-30435870 Trussville Crossing Blvd Ste 110, Birmingham, AL 35235, USASoHo Standard
HomewoodSoHo Standard is an intimate Homewood restaurant and wine bar that can host private celebrations and provide catering for wedding-related events such as rehearsal dinners.
Pricing on requestCuisine: small plates, pasta, steak +7Only individual menu item prices published (brunch, cocktails, dinner); no wedding catering packages or per-guest pricing.
intimatesouthernrelaxedwine barneighborhoodcasualSweet Peppers Deli
CullmanSweet Peppers Deli is a casual deli and catering business that offers group and event catering, including weddings, with a menu centered on sandwiches, salads, and fresh made-to-order items.
Pricing on requestCuisine: deli, sandwiches, salads +3Bar service: Nocasualdelisouthernfreshgroup-friendly
Which of these 35 fit your budget?
Tell us your budget, your area, and your guest count, and we'll rank every vendor on this page against it. About a minute, no account needed to see your matches.
Rank these for me